{"product_id":"proteintech-21112-1-ap","title":"Proteintech, 21112-1-AP, DKK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DKK1 (21112-1-AP) by Proteintech is a Polyclonal antibody targeting DKK1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21112-1-AP targets DKK1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse brain tissue,  K-562 cells,  HeLa  cells,  mouse heart tissue,  rat brain tissue,  rat heart tissue\nPositive IHC detected in: human gliomas tissue,  human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDKK1, also named a SK and Dickkopf-1, belongs to the dickkopf family. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. SDS-PAGE and Western blot analysis demonstrated that DKK1 is expressed as a 35-kDa doublet protein, which is larger than the deduced molecular mass of 26 kDa. Sometime DKK1 is expressed as a 42- to 50-kDa secreted protein, with little change observed after glycanase treatment.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, rabbit\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15110 Product name: Recombinant human DKK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-191 aa of BC001539 Sequence: TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLR Predict reactive species\nFull Name: dickkopf homolog 1 (Xenopus laevis)\nCalculated Molecular Weight: 266 aa, 29 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC001539\nGene Symbol: DKK1\nGene ID (NCBI): 22943\nRRID: AB_10733097\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94907\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868839760041,"sku":"21112-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21112-1-ap","provider":"Iright","version":"1.0","type":"link"}