{"product_id":"proteintech-21137-1-ap","title":"Proteintech, 21137-1-AP, SPACA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPACA3 (21137-1-AP) by Proteintech is a Polyclonal antibody targeting SPACA3 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21137-1-AP targets SPACA3 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  mouse testis tissue\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPACA3, also named as LYC3, LYZL3, SLLP1, SPRASA, CT54 and ALLP-17, belongs to the glycosyl hydrolase 22 family. It is a sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which is present in the extracellular matrix over the egg plasma membrane. SPACA3 has a Dimer form(PMID:15982649 ).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15589 Product name: Recombinant human SPACA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-123 aa of BC029867 Sequence: PYAGVCLAYFTSGFNAAALDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF Predict reactive species\nFull Name: sperm acrosome associated 3\nCalculated Molecular Weight: 215 aa, 23 kDa\nObserved Molecular Weight: 28-32 kDa, 46-50 kDa\nGenBank Accession Number: BC029867\nGene Symbol: SPACA3\nGene ID (NCBI): 124912\nRRID: AB_10913810\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IXA5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887812759721,"sku":"21137-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21137-1-ap","provider":"Iright","version":"1.0","type":"link"}