{"product_id":"proteintech-21141-1-ap","title":"Proteintech, 21141-1-AP, ITIH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ITIH1 (21141-1-AP) by Proteintech is a Polyclonal antibody targeting ITIH1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n21141-1-AP targets ITIH1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse auricular cartilage tissue, mouse cartilage tissue,  rat auricular cartilage tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nITIH1 (inter-alpha-trypsin inhibitor heavy chain 1), also named as IGHEP1 and SHAP. It is a key component of the inter-alpha-trypsin inhibitor (ITI) family, which plays a crucial role in extracellular matrix (ECM) stabilization and inflammation regulation. ITIH1 forms a complex with bikunin (a light chain) and other heavy chains (ITIH2, ITIH3, ITIH4), contributing to the stabilization of hyaluronan-rich matrices. The calculated molecular weight of the ITIH1 mature form is 101 kDa, but the actual observed molecular weight is about 76 kDa (PMID: 9677337).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15598 Product name: Recombinant human ITIH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 608-811 aa of BC069464 Sequence: SMSIRGMADQDGLKPTIDKPSEDSPPLEMLGPRRTFVLSALQPSPTHSSSNTQRLPDRVTGVDTDPHFIIHVPQKEDTLCFNINEEPGVILSLVQDPNTGFSVNGQLIGNKARSPGQHDGTYFGRLGIANPATDFQLEVTPQNITLNPGFGGPVFSWRDQAVLRQDGVVVTINKKRNLVVSVDDGGTFEVVLHRVWKGSSVHQD Predict reactive species\nFull Name: inter-alpha (globulin) inhibitor H1\nCalculated Molecular Weight: 911 aa, 101 kDa\nObserved Molecular Weight: 70-76 kDa\nGenBank Accession Number: BC069464\nGene Symbol: ITIH1\nGene ID (NCBI): 3697\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P19827\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887687913641,"sku":"21141-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21141-1-ap","provider":"Iright","version":"1.0","type":"link"}