{"product_id":"proteintech-21155-1-ap","title":"Proteintech, 21155-1-AP, SPINK7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPINK7 (21155-1-AP) by Proteintech is a Polyclonal antibody targeting SPINK7 in IHC, ELISA applications with reactivity to human samples\n21155-1-AP targets SPINK7 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPINK7, also named esophageal cancer-related gene 2 (ECRG 2), is a member of the SPINK protease inhibitor family. It is thought to function as a tumor suppressor gene regulating the protease cascades during carcinogenesis and invasion of esophageal cancer by regulation of migration through\nurokinase-type plasmin activator\/plasmin MAP kinase pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15727 Product name: Recombinant human SPINK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC109385 Sequence: MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC Predict reactive species\nFull Name: serine peptidase inhibitor, Kazal type 7 (putative)\nCalculated Molecular Weight: 85 aa, 9 kDa\nGenBank Accession Number: BC109385\nGene Symbol: SPINK7\nGene ID (NCBI): 84651\nRRID: AB_3085640\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P58062\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887814791337,"sku":"21155-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21155-1-ap","provider":"Iright","version":"1.0","type":"link"}