{"product_id":"proteintech-21173-1-ap","title":"Proteintech, 21173-1-AP, MYLK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYLK2 (21173-1-AP) by Proteintech is a Polyclonal antibody targeting MYLK2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21173-1-AP targets MYLK2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue,  Jurkat cells,  A549 cells,  rat skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYLK2, also named as MLCK2, belongs to the protein kinase superfamily and CAMK Ser\/Thr protein kinase family. MYLK2 catalyze the reaction: ATP + [myosin light-chain] = ADP + [myosin light-chain] phosphate. MYLK2 is implicated in the level of global muscle contraction and cardiac function. MYLK2 phosphorylates a specific serine in the N-terminus of a myosin light chain. Mutation of MYLK2 will cause the cardiomyopathy familial hypertrophic (CMH).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15424 Product name: Recombinant human MYLK2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-300 aa of BC069627 Sequence: MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASEKGDGTLAQPSTSSQGPKGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEQGASGSQDPGKPRVGKKAAEGQAAARRGSPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVC Predict reactive species\nFull Name: myosin light chain kinase 2\nCalculated Molecular Weight: 596 aa, 65 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC069627\nGene Symbol: MYLK2\nGene ID (NCBI): 85366\nRRID: AB_10733123\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H1R3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869474967721,"sku":"21173-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21173-1-ap","provider":"Iright","version":"1.0","type":"link"}