{"product_id":"proteintech-21176-1-ap","title":"Proteintech, 21176-1-AP, PDP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDP1 (21176-1-AP) by Proteintech is a Polyclonal antibody targeting PDP1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n21176-1-AP targets PDP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, mouse brain tissue,  mouse skeletal muscle tissue,  mouse heart tissue,  mouse liver tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human prostate cancer tissue, human thyroid cancer tissue,  mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPyruvate dehydrogenase phosphatase 1 (PDP1) is a key hormone-regulated metabolic enzyme that dephosphorylates and activates pyruvate dehydrogenase (PDH), thereby stimulating the conversion of pyruvate into acetyl-CoA (PMID: 36453802). PDP1 expression is regulated by FLT3-ITD in a context-dependent manner, and that it is centrally involved in the adaptation of AML glucose metabolism to the requirements of proliferation, survival and the therapeutic response to FLT3 inhibition (PMID: 37935978).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15453 Product name: Recombinant human PPM2C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC047619 Sequence: MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSSSYIPQSRLRYTPHPAYATFCRPKENWWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQA Predict reactive species\nFull Name: protein phosphatase 2C, magnesium-dependent, catalytic subunit\nCalculated Molecular Weight: 537 aa, 61 kDa\nObserved Molecular Weight: 55-61 kDa\nGenBank Accession Number: BC047619\nGene Symbol: PDP1\nGene ID (NCBI): 54704\nRRID: AB_2878824\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P0J1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868943765673,"sku":"21176-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21176-1-ap","provider":"Iright","version":"1.0","type":"link"}