{"product_id":"proteintech-21212-1-ap","title":"Proteintech, 21212-1-AP, SFRS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFRS2 (21212-1-AP) by Proteintech is a Polyclonal antibody targeting SFRS2 in WB, ELISA applications with reactivity to human samples\n21212-1-AP targets SFRS2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HeLa cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSFRS2, also named as PR264 and SC-35, belongs to the splicing factor SR family. SFRS2 is necessary for the splicing of pre-mRNA. It is required for formation of the earliest ATP-dependent splicing complex and interacts with spliceosomal components bound to both the 5'- and 3'-splice sites during spliceosome assembly. It also is required for ATP-dependent interactions of both U1 and U2 snRNPs with pre-mRNA. It binds to purine-rich RNA sequences, either 5'-AGSAGAGTA-3' (S=C or G) or 5'-GTTCGAGTA-3'. SFRS2 can bind to beta-globin mRNA and commit it to the splicing pathway. The antibody has no cross reaction to SFRS2B.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15612 Product name: Recombinant human SFRS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC070086 Sequence: MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRY Predict reactive species\nFull Name: splicing factor, arginine\/serine-rich 2\nCalculated Molecular Weight: 221 aa, 25 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC070086\nGene Symbol: SFRS2\nGene ID (NCBI): 6427\nRRID: AB_3085645\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01130\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887798997161,"sku":"21212-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21212-1-ap","provider":"Iright","version":"1.0","type":"link"}