{"product_id":"proteintech-21222-1-ap","title":"Proteintech, 21222-1-AP, CPLX4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CPLX4 (21222-1-AP) by Proteintech is a Polyclonal antibody targeting CPLX4 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n21222-1-AP targets CPLX4 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells\nPositive IP detected in: Y79 cells\nPositive IHC detected in: mouse eye tissue, human brain tissue,  rat eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15661 Product name: Recombinant human CPLX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 95-160 aa of BC106887 Sequence: MAGDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKEKAQATFTEIKQTAEQKCSVM Predict reactive species\nFull Name: complexin 4\nCalculated Molecular Weight: 160 aa, 18 kDa\nObserved Molecular Weight: 21-23 kDa\nGenBank Accession Number: BC106887\nGene Symbol: CPLX4\nGene ID (NCBI): 339302\nRRID: AB_10733348\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z7G2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886838468777,"sku":"21222-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21222-1-ap","provider":"Iright","version":"1.0","type":"link"}