{"product_id":"proteintech-21247-1-ap","title":"Proteintech, 21247-1-AP, ITIH3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ITIH3 (21247-1-AP) by Proteintech is a Polyclonal antibody targeting ITIH3 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n21247-1-AP targets ITIH3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human serum tissue\nPositive IP detected in: human plasma tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nITIH3, or inter-alpha-trypsin inhibitor heavy chain 3, is a gene in humans that encodes the heavy chain subunit of the pre-alpha-trypsin inhibitor complex. This complex plays a role in stabilizing the extracellular matrix through its ability to bind hyaluronic acid. The gene is located on chromosome 3 and is part of the inter-alpha-trypsin inhibitor family gene cluster. ITIH3 has restricted expression primarily toward the liver, with an RPKM value of 228.8, indicating a relatively high level of expression in this organ.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15750 Product name: Recombinant human ITIH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 601-782 aa of BC107604 Sequence: MVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGDPHFIIQIPEKDDALCFNIDEAPGTVLRLIQDAVTGLTVNGQITGDKRGSPDSKTRKTYFGKLGIANAQMDFQVEVTTEKITLWNRAVPSTFSWLDTVTVTQDGLSMMINRKNMVVSFGDGVTFVVVLHQVW Predict reactive species\nFull Name: inter-alpha (globulin) inhibitor H3\nCalculated Molecular Weight: 890 aa, 100 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC107604\nGene Symbol: ITIH3\nGene ID (NCBI): 3699\nRRID: AB_2878830\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q06033\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869413167273,"sku":"21247-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21247-1-ap","provider":"Iright","version":"1.0","type":"link"}