{"product_id":"proteintech-21287-1-ap","title":"Proteintech, 21287-1-AP, SLC39A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC39A2 (21287-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A2 in WB, IHC, ELISA applications with reactivity to human samples\n21287-1-AP targets SLC39A2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\nPositive IHC detected in: human colon cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC39A2 (hZIP2) is a human zinc importer in the ZIP family, which is essential in the maintenance of intracellular zinc homeostasis and is upregulated by zinc depletion. SLC39A2 is highly expressed in prostate epithelial cells and is involved in prostate cancer development. Most SLC39 proteins consist of eight transmembrane domains (TMDs), with extracellular or intravesicular amino and carboxy termini (PMID: 34790705). Zip2 gene knockout exacerbated myocardial I\/R injury, whereas Zip2 gene transfer reduced myocardial infarction (PMID: 31095941). The predicted molecular weight of SLC39A2 is 33 kDa, and a band of dimers at 66 kDa can also be detected by this antibody (PMID: 24619115).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15807 Product name: Recombinant human SLC39A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-175 aa of BC096723 Sequence: FMHMTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFLVFFLESLALQCCPGAAGGSTVQDEEWGGAHIFELHSHGHLPSPSKGPLRALVLLLSLSFH Predict reactive species\nFull Name: solute carrier family 39 (zinc transporter), member 2\nCalculated Molecular Weight: 309 aa, 33 kDa\nObserved Molecular Weight: 33 kDa, 66-70 kDa\nGenBank Accession Number: BC096723\nGene Symbol: SLC39A2\nGene ID (NCBI): 29986\nRRID: AB_3085650\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NP94\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806763177,"sku":"21287-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21287-1-ap","provider":"Iright","version":"1.0","type":"link"}