{"product_id":"proteintech-21290-1-ap","title":"Proteintech, 21290-1-AP, SMYD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMYD2 (21290-1-AP) by Proteintech is a Polyclonal antibody targeting SMYD2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human,  mouse, rat samples\n21290-1-AP targets SMYD2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cell, HEK-293 cells,  C2C12 cells,  U2OS cells,  mouse heart tissue,  rat heart tissue\nPositive IHC detected in: rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSMYD2, also known as SET and MYND domain containing 2, encodes an enzyme called N-lysine methyltransferase SMYD2, which plays a crucial role in cellular processes, including histone methylation, non-histone protein methylation, cell proliferation and differentiation, DNA repair (PMID: 18065756, PMID: 36191822). Aberrant SMYD2 expression has been linked to various cancers, including colon cancer, lung cancer, and cervical cancer. Smyd2 is strongly expressed in muscle cells with highest expression in the neonatal heart (PMID: 25125178).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15823 Product name: Recombinant human SMYD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC098305 Sequence: MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDK Predict reactive species\nFull Name: SET and MYND domain containing 2\nCalculated Molecular Weight: 433 aa, 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC098305\nGene Symbol: SMYD2\nGene ID (NCBI): 56950\nRRID: AB_10733881\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRG4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868877607081,"sku":"21290-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21290-1-ap","provider":"Iright","version":"1.0","type":"link"}