{"product_id":"proteintech-21327-1-ap","title":"Proteintech, 21327-1-AP, Cathepsin D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cathepsin D (21327-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin D in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n21327-1-AP targets Cathepsin D in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, HCT 116 cells,  HuH-7 cells,  HepG2 cells,  MCF-7 cells\nPositive IHC detected in: human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTSD (Cathepsin D) also named CPSD, belongs to the peptidase A1 family. It is ubiquitously expressed and is involved in proteolytic degradation, cell invasion, and apoptosis. Human CTSD is synthesized as a 52-kDa precursor that is converted into an active 48-kDa single-chain intermediate in the endosomes, and then into a fully active mature form, composed of a 34-kDa heavy chain and a 14-kDa light chain, in the lysosomes. It is a lysosomal acid protease found in neutrophils and monocytes and involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease (PMID: 27114232, PMID: 30717773, PMID: 30051532).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15254 Product name: Recombinant human Cathepsin D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 59-412 aa of BC016320 Sequence: VPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL Predict reactive species\nFull Name: cathepsin D\nCalculated Molecular Weight: 412 aa, 45 kDa\nObserved Molecular Weight: 32 kDa, 48 kDa, 52 kDa\nGenBank Accession Number: BC016320\nGene Symbol: Cathepsin D\nGene ID (NCBI): 1509\nRRID: AB_10733646\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07339\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868825669801,"sku":"21327-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21327-1-ap","provider":"Iright","version":"1.0","type":"link"}