{"product_id":"proteintech-21330-1-ap","title":"Proteintech, 21330-1-AP, C9orf7 \/ CACFD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C9orf7 \/ CACFD1 (21330-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf7 \/ CACFD1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n21330-1-AP targets C9orf7 \/ CACFD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalcium Channel Flower Domain Containing 1 (CACFD1) also named as C9orf7 or human Flower protein (hFWE). In Drosophila, cell selection uses a cell selection mechanism based on 'fitness fingerprints', which allow it to delay ageing, prevent developmental malformations and replace old tissues during regeneration. At the molecular level, these fitness fingerprints consist of combinations of Flower membrane proteins. Proteins that indicate reduced fitness are called Flower-Lose, because they are expressed in cells marked to be eliminated. It has different isoforms, the calculated MW rang from 14-25 kDa. 21330-1-AP can detect a band around 25 kDa.(PMID:31341286)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15336 Product name: Recombinant human C9orf7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC030558 Sequence: MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL Predict reactive species\nFull Name: chromosome 9 open reading frame 7\nCalculated Molecular Weight: 172 aa, 18 kDa\nObserved Molecular Weight: ~25 kDa\nGenBank Accession Number: BC030558\nGene Symbol: CACFD1\nGene ID (NCBI): 11094\nRRID: AB_3085651\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UGQ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885702107305,"sku":"21330-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21330-1-ap","provider":"Iright","version":"1.0","type":"link"}