{"product_id":"proteintech-21347-1-ap","title":"Proteintech, 21347-1-AP, YIPF7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YIPF7 (21347-1-AP) by Proteintech is a Polyclonal antibody targeting YIPF7 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n21347-1-AP targets YIPF7 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYIPF7, or Yip1 domain family, member 7, is a protein that is part of the YIPF protein family. It is involved in regulating membrane dynamics and may play a role in disease pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15695 Product name: Recombinant human YIPF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC103996 Sequence: MDLLKISHTKLHLLEDLSIKNKQRMSNLAQFDSDFYQSNFTIDNQEQSGNDSNAYGNLYGSRKQQAGEQPQPASFVPSEMLMSSGYAGQFFQPASNSDYYSQSPYIDSFD Predict reactive species\nFull Name: Yip1 domain family, member 7\nCalculated Molecular Weight: 280 aa, 31 kDa\nGenBank Accession Number: BC103996\nGene Symbol: YIPF7\nGene ID (NCBI): 285525\nRRID: AB_10734323\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N8F6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887926038697,"sku":"21347-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21347-1-ap","provider":"Iright","version":"1.0","type":"link"}