{"product_id":"proteintech-21366-1-ap","title":"Proteintech, 21366-1-AP, UGT3A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UGT3A2 (21366-1-AP) by Proteintech is a Polyclonal antibody targeting UGT3A2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n21366-1-AP targets UGT3A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MOLT-4 cells, human testis tissue,  THP-1 cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15835 Product name: Recombinant human UGT3A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 75-129 aa of BC103925 Sequence: QVISWLAPEDHQREFKKSFDFFLEETLGGRGKFENLLNVLEYLALQCSHFLNRKD Predict reactive species\nFull Name: UDP glycosyltransferase 3 family, polypeptide A2\nCalculated Molecular Weight: 523 aa, 60 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC103925\nGene Symbol: UGT3A2\nGene ID (NCBI): 167127\nRRID: AB_10888629\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q3SY77\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869785018537,"sku":"21366-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21366-1-ap","provider":"Iright","version":"1.0","type":"link"}