{"product_id":"proteintech-21438-1-ap","title":"Proteintech, 21438-1-AP, RNF150 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF150 (21438-1-AP) by Proteintech is a Polyclonal antibody targeting RNF150 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21438-1-AP targets RNF150 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue,  human heart tissue,  mouse brain tissue,  mouse eye tissue,  Y79 cells\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe RING finger (RNF) family, containing the N-terminal RING domain, is the largest E3 ubiquitin ligase family with 340 validated human members (PMID: 25609945). RNF150 proteins belong to the Goliath family and are involved in apoptosis and embryonic development (PMID: 19690564). RNF150 might be involved in the progression of GC partly via heparin binding which correlates well with angiogenesis and hematogenous metastasis (PMID: 37528105). There are four isoforms of RNF150, 48kDa, 44kDa, 43kDa, 32 kDa respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16064 Product name: Recombinant human RNF150 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-211 aa of BC101992 Sequence: LERNITVTMYITIGTRNLQKYVSRTSVVFVSISFIVLMIISLAWLVFYYIQRFRYANARDRNQRRLGDAAKKAISKLQIRTIKKGDKETESDFDNCAVCIEGYKPNDVVRILPCRHLFHK Predict reactive species\nFull Name: ring finger protein 150\nCalculated Molecular Weight: 438 aa, 48 kDa\nObserved Molecular Weight: 43-44 kDa\nGenBank Accession Number: BC101992\nGene Symbol: RNF150\nGene ID (NCBI): 57484\nRRID: AB_10733469\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULK6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869756281001,"sku":"21438-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21438-1-ap","provider":"Iright","version":"1.0","type":"link"}