{"product_id":"proteintech-21444-1-ap","title":"Proteintech, 21444-1-AP, Rubicon Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Rubicon (21444-1-AP) by Proteintech is a Polyclonal antibody targeting Rubicon in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21444-1-AP targets Rubicon in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, HeLa cells,  HepG2 cells\nPositive IHC detected in: human testis tissue,  human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRubicon (Run domain Beclin-1 interacting and cysteine-rich containing protein) consists of an N-terminal RUN domain, a middle region that includes its PI3K-binding domain (PIKBD), a coiled-coil domain (CCD), a serine-rich region (S-R), a helix-coil-rich domain (H-C) and a C-terminal Rubicon homology domain (RH) (PMID: 36288306). Rubicon is ubiquitously expressed in most tissues and organs. Western analysis detected bands at 130~150 kDa due to post-translational modification (PMID: 37898101, 35235784).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, escherichia coli\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13715 Product name: Recombinant human KIAA0226 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 61-290 aa of BC033615 Sequence: VAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLLVTKSQSLTALPSSTYTPPNSYAQHSYFGSFSSLHQSVPNNGSERRSTSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSVSALARDSPLTPNEMSSSTLTSPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSS Predict reactive species\nFull Name: KIAA0226\nCalculated Molecular Weight: 972 aa, 109 kDa\nObserved Molecular Weight: 130~150 kDa\nGenBank Accession Number: BC033615\nGene Symbol: Rubicon\nGene ID (NCBI): 9711\nRRID: AB_11182941\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92622\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868875083945,"sku":"21444-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21444-1-ap","provider":"Iright","version":"1.0","type":"link"}