{"product_id":"proteintech-21466-1-ap","title":"Proteintech, 21466-1-AP, TMEM230 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM230 (21466-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM230 in WB, IHC, ELISA applications with reactivity to human samples\n21466-1-AP targets TMEM230 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  COLO 320 cells,  HEK-293 cells,  HeLa cells\nPositive IHC detected in: human brain tissue, human colon cancer tissue,  human liver cancer tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe function of TMEM230\/C20orf30 has not been widely studied, and is yet to be fully elucidated. TMEM230 is primarily a transmembrane protein of synaptic vesicles in neurons. Disease-linked TMEM230 mutants impair synaptic vesicle trafficking leading to Parkinson's disease. Two isoforms were produced by alternative splicing with predicted MW of 13 and 20 kDa. 13 kDa isoform accounts for \u0026gt;95% of the total protein isoforms(27270108).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15080 Product name: Recombinant human C20orf30 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-120 aa of BC011990 Sequence: MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD Predict reactive species\nFull Name: chromosome 20 open reading frame 30\nCalculated Molecular Weight: 183 aa, 20 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC011990\nGene Symbol: TMEM230\nGene ID (NCBI): 29058\nRRID: AB_10791969\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96A57\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869387575465,"sku":"21466-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21466-1-ap","provider":"Iright","version":"1.0","type":"link"}