{"product_id":"proteintech-21520-1-ap","title":"Proteintech, 21520-1-AP, TNFRSF13B\/CD267 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNFRSF13B\/CD267 (21520-1-AP) by Proteintech is a Polyclonal antibody targeting TNFRSF13B\/CD267 in WB, ELISA applications with reactivity to human samples\n21520-1-AP targets TNFRSF13B\/CD267 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IM-9 cells, K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTumor necrosis factor receptor superfamily member 13B (TNFRSF13B), also known as CD267 or TACI, is a transmembrane protein of the TNF receptor superfamily found predominantly on B cells (PMID: 10920230). TACI is also expressed on activated T cells, myeloma cells, and expressed by monocytes intracellularly at a low level (PMID: 11429548; 16825497). TNFRSF13B is a receptor for TNFSF13\/APRIL\/CD256 and TNFSF13B\/BAFF\/CD257  and mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-κB and AP-1 (PMID: 10956646; 10973284; 9311921). It is involved in the stimulation of B- and T-cell function and the regulation of humoral immunity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16097 Product name: Recombinant human TNFRSF13B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 133-247 aa of BC109392 Sequence: LVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 13B\nCalculated Molecular Weight: 293 aa, 32 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC109392\nGene Symbol: TNFRSF13B\/CD267\nGene ID (NCBI): 23495\nRRID: AB_10888631\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14836\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887834419369,"sku":"21520-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21520-1-ap","provider":"Iright","version":"1.0","type":"link"}