{"product_id":"proteintech-21532-1-ap","title":"Proteintech, 21532-1-AP, KNCN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KNCN (21532-1-AP) by Proteintech is a Polyclonal antibody targeting KNCN in IHC, ELISA applications with reactivity to human, mouse samples\n21532-1-AP targets KNCN in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKinocilin (KNCN) was first detected in the kinocilia of vestibular and auditory hair cells at embryonic days 14.5 and 18.5, respectively. In mature auditory hair cells, KNCN was present at the cuticular plate, at the base of each stereocilium. KNCN was also expressed by the pillar cells and Deiters cells, both of which contain prominent transcellular and apical bundles of microtubules. KNCN expression was detected in both cochlear and vestibular hair cells. KNCN plays a role in stabilizing dense microtubular networks or invesicular trafficking (PMID: 30254566).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16160 Product name: Recombinant human KNCN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-75 aa of BC101295 Sequence: GLLILAYPFLKARFNLDHILPTIGSLRIHPHPGADHGEGRSSTNGNKEGARSSLSTVSRTLEKLKPGTRGAEEC Predict reactive species\nFull Name: kinocilin\nCalculated Molecular Weight: 124 aa, 13 kDa\nGenBank Accession Number: BC101295\nGene Symbol: KNCN\nGene ID (NCBI): 148930\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A6PVL3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887698989225,"sku":"21532-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21532-1-ap","provider":"Iright","version":"1.0","type":"link"}