{"product_id":"proteintech-21552-1-ap","title":"Proteintech, 21552-1-AP, MARK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MARK1 (21552-1-AP) by Proteintech is a Polyclonal antibody targeting MARK1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n21552-1-AP targets MARK1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HeLa cells,  SH-SY5Y cells,  mouse kidney tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMARK1, also named as MAP-microtubule affinity regulating kinase 1, which form a subfamily of the calcium\/calmodulin-dependent protein kinase (CAMP) group of kinases(PMID: 22670221).\nIt is involved in cell polarity by phosphorylating the microtubule-associated proteins MAP2, MAP4 and MAPT\/TAU at KXGS motifs, causing detachment from microtubules, and their disassembly. MARK1 also act as a regulator of the neuronal migration and Wnt signaling pathway.\nIt has 3 isoforms which molecular weight is 89,84,72 kDa. This antibody may detect all of the isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16225 Product name: Recombinant human MARK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 506-611 aa of BC113869 Sequence: VCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSR Predict reactive species\nFull Name: MAP\/microtubule affinity-regulating kinase 1\nCalculated Molecular Weight: 795 aa, 89 kDa\nObserved Molecular Weight: 85-89 kDa, 72 kDa\nGenBank Accession Number: BC113869\nGene Symbol: MARK1\nGene ID (NCBI): 4139\nRRID: AB_10732726\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P0L2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868925776041,"sku":"21552-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21552-1-ap","provider":"Iright","version":"1.0","type":"link"}