{"product_id":"proteintech-21568-1-ap","title":"Proteintech, 21568-1-AP, SLC25A25 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A25 (21568-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A25 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21568-1-AP targets SLC25A25 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells,  RAW264.7 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16086 Product name: Recombinant human SLC25A25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC103933 Sequence: MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQ Predict reactive species\nFull Name: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25\nCalculated Molecular Weight: 469 aa, 53 kDa\nObserved Molecular Weight: 50 kDa, 100 kDa\nGenBank Accession Number: BC103933\nGene Symbol: SLC25A25\nGene ID (NCBI): 114789\nRRID: AB_10858638\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6KCM7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869765259433,"sku":"21568-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21568-1-ap","provider":"Iright","version":"1.0","type":"link"}