{"product_id":"proteintech-21583-1-ap","title":"Proteintech, 21583-1-AP, ZNF75D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF75D (21583-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF75D in WB, ELISA applications with reactivity to human, mouse samples\n21583-1-AP targets ZNF75D in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF75D (zinc finger protein 75D), also known as ZNF75. It is expected to be located in nucleus  and ubiquitous expression in prostate and adrenal. The calculated molecular weight of METAP1 is 60 kDa. The gene encodes a protein that likely functions as a transcription factor. ZNF75D belongs to the ZNF75 family, includes an N-terminal SCAN domain, a KRAB box, and five C2H2-type zinc finger motifs. Another functional gene belonging to this family is located on chromosome 16, while pseudogenes have been identified on chromosomes 11 and 12 (PMID: 8661144). It may be involved in transcriptional regulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16139 Product name: Recombinant human ZNF75D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 164-233 aa of BC109100 Sequence: AEPQPMGVFQKEYWNTYRVLQEQLGWNTHKETQPVYERAVHDQQMLALSEQKRIKHWKMASKLILPESLS Predict reactive species\nFull Name: zinc finger protein 75D\nCalculated Molecular Weight: 510 aa, 59 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC109100\nGene Symbol: ZNF75D\nGene ID (NCBI): 7626\nRRID: AB_3085661\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51815\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887953301673,"sku":"21583-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21583-1-ap","provider":"Iright","version":"1.0","type":"link"}