{"product_id":"proteintech-21590-1-ap","title":"Proteintech, 21590-1-AP, OGFOD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OGFOD2 (21590-1-AP) by Proteintech is a Polyclonal antibody targeting OGFOD2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21590-1-AP targets OGFOD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human testis tissue,  human skeletal muscle tissue,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: mouse brain tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOGFOD2 belongs to the OGFOD2 family. OGFOD2 has 4 isoforms with the molecular mass of 15, 20, 32 and 39 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16164 Product name: Recombinant human OGFOD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC098293 Sequence: FTAPFCQALLEELEHFEQSDMPKGRPNTMNNYGVLLHELGLDEPLMTPLRERFLQPLMALLYPDCGGGRLDSHRAFVVKYAPGQDLELGCHYDNAELTLNVALGKVFTGGALYFGGLFQAPTALTEPLEVEHVVGQGVLHRGGQLHGARPLGTGERWNLVVWLRASAVRNSLCPMCCREPDLVDDEGFGDGFTREEPATVDVCALT Predict reactive species\nFull Name: 2-oxoglutarate and iron-dependent oxygenase domain containing 2\nCalculated Molecular Weight: 350 aa, 39 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC098293\nGene Symbol: OGFOD2\nGene ID (NCBI): 79676\nRRID: AB_10734327\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6N063\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887745388713,"sku":"21590-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21590-1-ap","provider":"Iright","version":"1.0","type":"link"}