{"product_id":"proteintech-21593-1-ap","title":"Proteintech, 21593-1-AP, NGX6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NGX6 (21593-1-AP) by Proteintech is a Polyclonal antibody targeting NGX6 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n21593-1-AP targets NGX6 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human stomach cancer tissue, human colon cancer tissue,  mouse intestine,  rat small intestine tissue,  rat stomach tissue,  mouse stomach tissue,  mouse testis tissue,  human cervical cancer tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNGX6 (also known as TMEM8B or C9orf127) is a transmembrane protein containing an epidermal growth factor (EGF)-like domain. It may function as a regulator of the EGFR pathway. NGX6 has been reported as a tumor suppressor which may function in cell growth, proliferation and adhesion (PMID: 19755717; 12918109; 20705583).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16167 Product name: Recombinant human C9orf127 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-191 aa of BC098296 Sequence: MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVWMRTFLSPCVDDCG Predict reactive species\nFull Name: chromosome 9 open reading frame 127\nCalculated Molecular Weight: 472 aa, 52 kDa\nGenBank Accession Number: BC098296\nGene Symbol: NGX6\nGene ID (NCBI): 51754\nRRID: AB_2878889\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A6NDV4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887736574121,"sku":"21593-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21593-1-ap","provider":"Iright","version":"1.0","type":"link"}