{"product_id":"proteintech-21612-1-ap","title":"Proteintech, 21612-1-AP, PFTK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PFTK1 (21612-1-AP) by Proteintech is a Polyclonal antibody targeting PFTK1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n21612-1-AP targets PFTK1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  mouse brain tissue,  SH-SY5Y cells\nPositive IHC detected in: human kidney tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPFTK1 is a Cdc2-related protein kinase, also named as PFTAIRE1, CDK14 and belongs to the CMGC Ser\/Thr protein kinase family and CDC2\/CDKX subfamily. It acts as a cyclin-dependent kinases that regulates cell cycle progression and cell proliferation. The PFTK1 protein shows high homology with mouse Pftaire1, a Cdc2-related protein expressed primarily in the postnatal and adult nervous system(PMID:9202329). The protein contains 2 predicted nuclear localization signals that the N-terminal nuclear localization signals do not play a role in vivo(PMID:11313143). It has 3 isoforms produced by alternative splicing. This antibody is specific to PFTK1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16259 Product name: Recombinant human PFTK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 303-451 aa of BC136477 Sequence: IFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH Predict reactive species\nFull Name: PFTAIRE protein kinase 1\nCalculated Molecular Weight: 469 aa, 53 kDa\nObserved Molecular Weight: 48-53 kDa\nGenBank Accession Number: BC136477\nGene Symbol: PFTK1\nGene ID (NCBI): 5218\nRRID: AB_10858924\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94921\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869006450857,"sku":"21612-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21612-1-ap","provider":"Iright","version":"1.0","type":"link"}