{"product_id":"proteintech-21619-1-ap","title":"Proteintech, 21619-1-AP, FHL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FHL2 (21619-1-AP) by Proteintech is a Polyclonal antibody targeting FHL2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n21619-1-AP targets FHL2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U2OS cells,  hTERT-RPE1 cells,  NIH\/3T3 cells\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human cervical cancer tissue, human skin cancer tissue,  mouse kidney tissue,  mouse ovary tissue,  rat heart tissue,  rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFHL2(Four and a half LIM domains protein 2), also known as DRAL. It is located in cytoplasm and nucleus. The protein is expressed in skeletal muscle and heart. May function as a molecular transmitter linking various signaling pathways to transcriptional regulation. Negatively regulates the transcriptional repressor E4F1 and may function in cell growth. Inhibits the transcriptional activity of FOXO1 and its apoptotic function by enhancing the interaction of FOXO1 with SIRT1 and FOXO1 deacetylation. Negatively regulates the calcineurin\/NFAT signaling pathway in cardiomyocytes (PMID: 28717008). The molecular weight of FHL2 is 32 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1378 Product name: Recombinant human FHL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-279 aa of BC014397 Sequence: MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI Predict reactive species\nFull Name: four and a half LIM domains 2\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC014397\nGene Symbol: FHL2\nGene ID (NCBI): 2274\nRRID: AB_10860263\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14192\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868897202345,"sku":"21619-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21619-1-ap","provider":"Iright","version":"1.0","type":"link"}