{"product_id":"proteintech-21620-1-ap","title":"Proteintech, 21620-1-AP, TMED9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMED9 (21620-1-AP) by Proteintech is a Polyclonal antibody targeting TMED9 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig samples\n21620-1-AP targets TMED9 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells,  pig liver tissue,  mouse lung tissue,  mouse pancreas tissue,  mouse brain tissue,  mouse liver tissue,  rat liver tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMED9 (also named as GMP25, GP25L2 or p25) is a member of the EMP24\/GP25L family. TMED9 probably forms hetero-oligomeric complexes with TMED7 (p27), TMED2 (p24), and TMED10 (p23) (PMID: 10359607). Located in the endoplasmic reticulum and the Golgi, TMED9 appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway (PMID: 9472029; 10359607).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13813 Product name: Recombinant human TMED9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-224 aa of BC001123 Sequence: MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRH Predict reactive species\nFull Name: transmembrane emp24 protein transport domain containing 9\nCalculated Molecular Weight: 235 aa, 27 kDa\nObserved Molecular Weight: 24-27 kDa\nGenBank Accession Number: BC001123\nGene Symbol: TMED9\nGene ID (NCBI): 54732\nRRID: AB_10858623\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BVK6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868930789545,"sku":"21620-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21620-1-ap","provider":"Iright","version":"1.0","type":"link"}