{"product_id":"proteintech-21630-1-ap","title":"Proteintech, 21630-1-AP, ZSCAN29 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZSCAN29 (21630-1-AP) by Proteintech is a Polyclonal antibody targeting ZSCAN29 in WB, IHC, ELISA applications with reactivity to human samples\n21630-1-AP targets ZSCAN29 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IHC detected in: human colon tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZSCAN29 (zinc finger and SCAN domain containing 29), also named as ZNF690 or Zfp690. It is predicted to be located in nucleus and ubiquitous expression in testis and lymph node. The calculated molecular weight of ZSCAN29 is 96 kDa. The genes ZSCAN29 (associated with five disorders: SCZ, BIP, MD, ASD and ADHD) and ZSCAN31 (associated with three disorders: SCZ, BIP and MD) encode zing finger transcription factor proteins that belong to the krueppel C2H2-type zinc-finger protein family. Zinc finger proteins are essential in multiple regulatory mechanisms and some have been associated with psychiatric disorders as reviewed by Squassina et al., 2019 (PMID: 34637873). It also enables sequence-specific double-stranded DNA binding activity and be predicted to be involved in regulation of transcription by RNA polymerase II.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16239 Product name: Recombinant human ZSCAN29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 99-304 aa of BC109271 Sequence: PGRPRSSVTVSVKGQEVRLEKMTPPKSSQELLSVRQESVEPQPRGVPKKERARSPDLGPQEQMNPKEKLKPFQRSGFEAGFENEDNSKRDISEEVQLHRTLLARSERKIPRYLHQGKGNESDCRSGRQWAKTSGEKRGKLTLPEKSLSEVLSQQRPCLGERPYKYLKYSKSFGPNSLLMHQVSHQVENPYKCADCGKSFSRSARLI Predict reactive species\nFull Name: zinc finger and SCAN domain containing 29\nCalculated Molecular Weight: 852 aa, 97 kDa\nObserved Molecular Weight: 96-97 kDa\nGenBank Accession Number: BC109271\nGene Symbol: ZSCAN29\nGene ID (NCBI): 146050\nRRID: AB_3085664\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IWY8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887954776233,"sku":"21630-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21630-1-ap","provider":"Iright","version":"1.0","type":"link"}