{"product_id":"proteintech-21633-1-ap","title":"Proteintech, 21633-1-AP, MAP1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAP1B (21633-1-AP) by Proteintech is a Polyclonal antibody targeting MAP1B in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse samples\n21633-1-AP targets MAP1B in WB, IHC, IF-P, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse cerebellum tissue,  human brain tissue\nPositive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMicrotubule-associated protein 1B (MAP1B) is a cytoskeleton protein which can promote microtubule assembly. Previous reports have suggested that this protein is closely involved in neuronal development based on its extensive expression in the developing brain and moderate in mature neurons. Gene disruption or knockout studies of the MAP1B gene led to a delayed development of the nervous system in mice. It includes the N-terminal heavy chain and a C-terminal light chain. The MAP1B heavy chain has a microtubule-stabilization effect, and contains an actin-binding site that may play a role in the crosslinking of actin and microtubules, a function that may be important in neurite elongation. Various isoforms around 300-350 kDa of MAP1B can be observed due to the differences in phosphorylation state. (10704485)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16255 Product name: Recombinant human MAP1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 414-567 aa of BC141853 Sequence: DSRESLKPAAKPLPSKSVRKESKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPVKTETKPSVTEKEVPSKEEPSPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEVAKKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEK Predict reactive species\nFull Name: microtubule-associated protein 1B\nCalculated Molecular Weight: 2468 aa, 271 kDa\nObserved Molecular Weight: 320 kDa\nGenBank Accession Number: BC141853\nGene Symbol: MAP1B\nGene ID (NCBI): 4131\nRRID: AB_10793666\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46821\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868898087081,"sku":"21633-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21633-1-ap","provider":"Iright","version":"1.0","type":"link"}