{"product_id":"proteintech-21639-1-ap","title":"Proteintech, 21639-1-AP, GBX2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GBX2 (21639-1-AP) by Proteintech is a Polyclonal antibody targeting GBX2 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n21639-1-AP targets GBX2 in WB, IHC, IF\/ICC, IP, chIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse stomach tissue, HeLa cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHomeobox protein GBX-2 (GBX-2) is a homeobox gene essential for normal development of the midbrain and the anterior hindbrain. It mainly expressed in the brain, and located in nucleoplasm. It is presumably a transcription factor that is likely to regulate the expression of genes involved in establishing early A\/P pattern in the neural plate (PMID: 9247335).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16288 Product name: Recombinant human GBX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-248 aa of BC137448 Sequence: LPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGSTTSTGKNR Predict reactive species\nFull Name: gastrulation brain homeobox 2\nCalculated Molecular Weight: 348 aa, 37 kDa\nObserved Molecular Weight: 33-37 kDa\nGenBank Accession Number: BC137448\nGene Symbol: GBX2\nGene ID (NCBI): 2637\nRRID: AB_2878896\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52951\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868998160553,"sku":"21639-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21639-1-ap","provider":"Iright","version":"1.0","type":"link"}