{"product_id":"proteintech-21653-1-ap","title":"Proteintech, 21653-1-AP, HOXB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HOXB1 (21653-1-AP) by Proteintech is a Polyclonal antibody targeting HOXB1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n21653-1-AP targets HOXB1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, NIH\/3T3 cells,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHOXB1, also named as HOX2I, belongs to the Antp homeobox family and the Labial subfamily. HOXB1 is sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. HOXB1 acts on the anterior body structures. Establishment of the spatial colinearity in the embryo is directly controlled by the Hox genes themselves. 21653-1-AP is a rabbit polyclonal antibody raised against residues near the N-terminus of human  HOXB1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16366 Product name: Recombinant human HOXB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC096192 Sequence: MDYNRMNSFLEYPLCNRGPSAYSAHSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGHSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKE Predict reactive species\nFull Name: homeobox B1\nCalculated Molecular Weight: 235 aa, 26 kDa\nObserved Molecular Weight: 32, 25 kDa\nGenBank Accession Number: BC096192\nGene Symbol: HOXB1\nGene ID (NCBI): 3211\nRRID: AB_2878899\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P14653\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887670284457,"sku":"21653-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21653-1-ap","provider":"Iright","version":"1.0","type":"link"}