{"product_id":"proteintech-21657-1-ap","title":"Proteintech, 21657-1-AP, CNGA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNGA3 (21657-1-AP) by Proteintech is a Polyclonal antibody targeting CNGA3 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse samples\n21657-1-AP targets CNGA3 in WB, IP, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCNGA3 is a member of the cyclic nucleotide-gated cation channel protein family which is required for normal vision and olfactory signal transduction. Mutations in CNGA3 gene are associated with achromatopsia (rod monochromacy) and color blindness. Three alternatively spliced transcripts encoding different isoforms have been described. This antibody detects CNGA3 with an apparent molecular weight of 98 kDa which has been reported (PMID: 20378608).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16385 Product name: Recombinant human CNGA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 590-694 aa of BC096298 Sequence: EYPEAKKALEEKGRQILMKDNLIDEELARAGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQVKGGGDKPLADGEVPGDATKTEDKQQ Predict reactive species\nFull Name: cyclic nucleotide gated channel alpha 3\nCalculated Molecular Weight: 694 aa, 79 kDa\nObserved Molecular Weight: 98 kDa\nGenBank Accession Number: BC096298\nGene Symbol: CNGA3\nGene ID (NCBI): 1261\nRRID: AB_10734591\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16281\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886668665001,"sku":"21657-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21657-1-ap","provider":"Iright","version":"1.0","type":"link"}