{"product_id":"proteintech-21673-1-ap","title":"Proteintech, 21673-1-AP, KRTAP3-1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KRTAP3-1 (21673-1-AP) by Proteintech is a Polyclonal antibody targeting KRTAP3-1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n21673-1-AP targets KRTAP3-1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skin tissue, rat skin tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKRTAP3-1 is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16508 Product name: Recombinant human KRTAP3-1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-98 aa of BC113077 Sequence: PHEISLLQPICCDTCPPPCCKPDTYVPTCWLLNNCHPTPGLSGINLTTYVQPGCESPCEPRC Predict reactive species\nFull Name: keratin associated protein 3-1\nCalculated Molecular Weight: 98 aa, 11 kDa\nObserved Molecular Weight: 10-15 kDa\nGenBank Accession Number: BC113077\nGene Symbol: KRTAP3-1\nGene ID (NCBI): 83896\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BYR8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887699808425,"sku":"21673-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21673-1-ap","provider":"Iright","version":"1.0","type":"link"}