{"product_id":"proteintech-21696-1-ap","title":"Proteintech, 21696-1-AP, Teneurin 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Teneurin 1 (21696-1-AP) by Proteintech is a Polyclonal antibody targeting Teneurin 1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21696-1-AP targets Teneurin 1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, H69\/H146 cells,  rat brain tissue\nPositive IHC detected in: human brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nODZ1 (also known as teneurin-1, TENM1), which plays a key role in central nervous system ontogenesis. ODZ1 is upregulated in Glioblastoma cells through a Stat3-mediated pathway activated by IL-6, which is released by tumor-associated monocytes. In addition, a hypoxic microenvironment regulates GBM tumor cell migration in part by inducing ODZ1 through hypomethylation of a CpG island in the ODZ1 promoter.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16289 Product name: Recombinant human ODZ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC140783 Sequence: MEQTDCKPYQPLPKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHEYNQELRMNYNSQSRKRKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVDTETEGAASPDHALRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQDVQSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSPAAPAPPTSTQDSVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNY Predict reactive species\nFull Name: odz, odd Oz\/ten-m homolog 1(Drosophila)\nCalculated Molecular Weight: 2732 aa, 306 kDa\nObserved Molecular Weight: 305 kDa\nGenBank Accession Number: BC140783\nGene Symbol: Teneurin 1\nGene ID (NCBI): 10178\nRRID: AB_10858625\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKZ4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869612200105,"sku":"21696-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21696-1-ap","provider":"Iright","version":"1.0","type":"link"}