{"product_id":"proteintech-21698-1-ap","title":"Proteintech, 21698-1-AP, NEDD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NEDD4 (21698-1-AP) by Proteintech is a Polyclonal antibody targeting NEDD4 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, monkey samples\n21698-1-AP targets NEDD4 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, C6 cells,  HeLa cells,  HT-1080 cells,  HEK-293 cells,  Jurkat cells,  NIH\/3T3 cells,  COS-7 cells\nPositive IP detected in: C6 cells\nPositive IHC detected in: human breast cancer tissue, human lung cancer tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNEDD4 and similar proteins discovered subsequently became a family of HECT ligases, comprising 9 human proteins including NEDD4, NEDD4-2 (NEDD4L), ITCH, SMURF1, SMURF2, WWP1, WWP2, NEDL1 and NEDL2 (PMID: 23545411). NEDD4 is a highly evolutionarily conserved protein from yeast to man, and was initially cloned as a highly expressed gene in the early embryonic brain (PMID: 35328067). NEDD4 is frequently overexpressed in many different types of cancer, and decreased levels of NEDD4 can also be associated with cancer. It can be a potential therapeutic target for the treatment of human cancer.(PMID: 25527121). The human NEDD4 gene is located on chromosome 15q21.3 and comprises 30 exons (HGNC:7727) shown to encode a ~120 KDa protein. Otherwise there is a 75 kDa isoform in addition to full length NEDD4 (PMID: 24907641).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, monkey\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16291 Product name: Recombinant human NEDD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 970-1319 aa of BC152452 Sequence: TVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD Predict reactive species\nFull Name: neural precursor cell expressed, developmentally down-regulated 4\nCalculated Molecular Weight: 1319 aa, 149 kDa\nObserved Molecular Weight: 115 kDa\nGenBank Accession Number: BC152452\nGene Symbol: NEDD4\nGene ID (NCBI): 4734\nRRID: AB_10858626\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46934\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868836810921,"sku":"21698-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21698-1-ap","provider":"Iright","version":"1.0","type":"link"}