{"product_id":"proteintech-21699-1-ap","title":"Proteintech, 21699-1-AP, DCLK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DCLK1 (21699-1-AP) by Proteintech is a Polyclonal antibody targeting DCLK1 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples\n21699-1-AP targets DCLK1 in WB, IHC, IF-P, IF-Fro, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue,  human brain tissue,  mouse brain tissue\nPositive IP detected in: rat brain tissue\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF-Fro detected in: rat brain tissue, mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDCLK1 (Serine\/threonine-protein kinase DCLK1) is also named as DCAMKL1, DCDC3A, KIAA0369 and belongs to the CAMK Ser\/Thr protein kinase family. It is a microtubule-associated kinase that can undergo autophosphorylation and it also has microtubule-polymerizing activity that is independent of its protein kinase activity (PMID: 11124993). It plays a unique role in mitotic spindle integrity during early neurogenesis in radial glial cell proliferation and their radial process stability. DCLK1 is a unique marker for distinguishing tumor stem cells from intestinal normal stem cells (PMID: 23202126). This protein has 4 isoforms produced by alternative splicing with the molecular weight of 82 kDa, 81 kDa, 47 kDa and 48 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16292 Product name: Recombinant human DCLK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 623-729 aa of BC152456 Sequence: LITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM Predict reactive species\nFull Name: doublecortin-like kinase 1\nCalculated Molecular Weight: 729 aa, 81 kDa\nObserved Molecular Weight: 48 kDa, 82 kDa\nGenBank Accession Number: BC152456\nGene Symbol: DCLK1\nGene ID (NCBI): 9201\nRRID: AB_10859251\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15075\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868896579753,"sku":"21699-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21699-1-ap","provider":"Iright","version":"1.0","type":"link"}