{"product_id":"proteintech-21704-1-ap","title":"Proteintech, 21704-1-AP, HLA-DMB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HLA-DMB (21704-1-AP) by Proteintech is a Polyclonal antibody targeting HLA-DMB in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n21704-1-AP targets HLA-DMB in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Raji cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). The class II molecules are composed of two non-covalently associated alpha and beta chains. HLA-DMA and HLA-DMB form a functional heterodimer that is critical in the pathway of class II antigen presentation. HLA-DM plays a critical role in catalyzing the release of Class II HLA-associated invariant chain-derived peptides (CLIP) from newly synthesized class II HLA molecules and freeing the peptide binding site for acquisition of antigenic peptides.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16320 Product name: Recombinant human HLA-DMB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-263 aa of BC027175 Sequence: MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS Predict reactive species\nFull Name: major histocompatibility complex, class II, DM beta\nCalculated Molecular Weight: 263 aa, 29 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC027175\nGene Symbol: HLA-DMB\nGene ID (NCBI): 3109\nRRID: AB_2878907\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P28068\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869548466345,"sku":"21704-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21704-1-ap","provider":"Iright","version":"1.0","type":"link"}