{"product_id":"proteintech-21745-1-ap","title":"Proteintech, 21745-1-AP, VNN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VNN1 (21745-1-AP) by Proteintech is a Polyclonal antibody targeting VNN1 in WB, ELISA applications with reactivity to human, mouse samples\n21745-1-AP targets VNN1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat kidney tissue, BxPC-3 cells,  mouse kidney tissue,  PC-13 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVNN1(Vascular non-inflammatory molecule 1) is also named as Vanin-1, Pantetheinase, Tiff66. It is a GPI-anchored 70-kDa protein with a high degree of homology with GPI-80 (also known as VNN2), a molecule expressed by human phagocytes and involved in leukocyte adhesion and migration. Vanin-1 is predominantly expressed by resident tissue cells and acts at the level of epithelial cells and surrounding hematopoietic cells by paracrine 2-Mercaptoethylamine release(PMID:17163446). The full length VNN1 has a signal peptide, a propeptide and six glycosylation sites. According to some authors, the variations which varied between 55 and 72kDa may be due to different degrees of glycosylation of the protein and cleavage (JOSE A et al. 2001).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16501 Product name: Recombinant human VNN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 302-513 aa of BC096268 Sequence: SQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSAETASTRFEMFSLSGTFGTQYVFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVLTVTLFGRLYEKDWASNASSGLTAQARIIMLIVIAPIVCSLSW Predict reactive species\nFull Name: vanin 1\nCalculated Molecular Weight: 513 aa, 57 kDa\nObserved Molecular Weight: 55-72 kDa\nGenBank Accession Number: BC096268\nGene Symbol: VNN1\nGene ID (NCBI): 8876\nRRID: AB_10734328\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95497\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868922204329,"sku":"21745-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21745-1-ap","provider":"Iright","version":"1.0","type":"link"}