{"product_id":"proteintech-21762-1-ap","title":"Proteintech, 21762-1-AP, EPHB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPHB1 (21762-1-AP) by Proteintech is a Polyclonal antibody targeting EPHB1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n21762-1-AP targets EPHB1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, SK-N-SH cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEPHB1, also named as EPHT2, NET, HEK6 and ELK, belongs to the protein kinase superfamily, Tyr protein kinase family, and Ephrin receptor subfamily. It is a receptor for members of the ephrin-B family. EPHB1 binds to ephrin-B1, -B2 and -B3. EPHB1 may be involved in cell-cell interactions in the nervous system. EPHB1 catalyzes the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16347 Product name: Recombinant human EPHB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 247-371 aa of BC111744 Sequence: MVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCS Predict reactive species\nFull Name: EPH receptor B1\nCalculated Molecular Weight: 984 aa, 110 kDa\nObserved Molecular Weight: 110-120 kDa\nGenBank Accession Number: BC111744\nGene Symbol: EPHB1\nGene ID (NCBI): 2047\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P54762\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887605600425,"sku":"21762-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21762-1-ap","provider":"Iright","version":"1.0","type":"link"}