{"product_id":"proteintech-21774-1-ap","title":"Proteintech, 21774-1-AP, CACNA1C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CACNA1C (21774-1-AP) by Proteintech is a Polyclonal antibody targeting CACNA1C in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n21774-1-AP targets CACNA1C in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalcium voltage-gated channel subunit alpha1 C (CACNA1C, also known as CACH2 and Cav1.2) couples transient activation of inward calcium current to transcriptional regulation and plays an important role in dendritic development, neuronal survival, synaptic plasticity, memory formation, learning, and behavior (PMID: 21248242;  16251435; 20169575; 19047462; 18174367). Genetic variation in CACNA1C has also been associated with depression, schizophrenia, and autism spectrum disorders, as well as changes in brain function and structure in control subjects who have no diagnosable psychiatric illness (PMID: 22705413).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, rabbit\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16455 Product name: Recombinant human L-VOCC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1835-2135 aa of BC146846 Sequence: EVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPVPTLRLEGVESSEKLNSSFPSIHCGSWAETTPGGGGSSAARRVRPVSLMVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL Predict reactive species\nFull Name: calcium channel, voltage-dependent, L type, alpha 1C subunit\nCalculated Molecular Weight: 249 kDa\nObserved Molecular Weight: 249 kDa\nGenBank Accession Number: BC146846\nGene Symbol: CACNA1C\nGene ID (NCBI): 775\nRRID: AB_2878918\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13936\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868861190313,"sku":"21774-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21774-1-ap","provider":"Iright","version":"1.0","type":"link"}