{"product_id":"proteintech-21799-1-ap","title":"Proteintech, 21799-1-AP, LDHA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LDHA (21799-1-AP) by Proteintech is a Polyclonal antibody targeting LDHA in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n21799-1-AP targets LDHA in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MCF-7 cells,  human testis tissue,  A375 cells,  HepG2 cells,  NIH\/3T3 cells,  MDA-MB-231 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:30000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLactate dehydrogenase (LDH) is composed of A subunits predominate in skeletal muscle and B subunits are abundantly produced in brain and heart. The LDHA (lactate dehydrogenase A) and COPB1 (coatomer protein complex, subunit beta 1)genes, are involved in energy metabolism and protein transport processes. Both genes might play important roles in muscle development. It has some isoforms with the molecular mass of 27-40 kDa and can form a homotetramer(PMID:11276087).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16703 Product name: Recombinant human LDHA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 283-332 aa of BC067223 Sequence: IKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF Predict reactive species\nFull Name: lactate dehydrogenase A\nCalculated Molecular Weight: 332 aa, 37 kDa\nObserved Molecular Weight: 32-37 kDa\nGenBank Accession Number: BC067223\nGene Symbol: LDHA\nGene ID (NCBI): 3939\nRRID: AB_10858925\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00338\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868832485545,"sku":"21799-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21799-1-ap","provider":"Iright","version":"1.0","type":"link"}