{"product_id":"proteintech-21803-1-ap","title":"Proteintech, 21803-1-AP, ID4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ID4 (21803-1-AP) by Proteintech is a Polyclonal antibody targeting ID4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21803-1-AP targets ID4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, K-562 cells,  MDA-MB-231 cells,  mouse testis tissue\nPositive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nID4 (inhibitor of DNA binding 4) negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. (PMID: 19783986). ID4 levels dictate the stem cell state in mouse spermatogonia (PMID: 28087628). It is involved in the regulation of many cellular processes during both prenatal development and tumorigenesis. ID4 can be detected 25-30 kDa (PMID: 34108007, PMID: 31847356).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16883 Product name: Recombinant human ID4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC014941 Sequence: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND Predict reactive species\nFull Name: inhibitor of DNA binding 4, dominant negative helix-loop-helix protein\nCalculated Molecular Weight: 161 aa, 17 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC014941\nGene Symbol: ID4\nGene ID (NCBI): 3400\nRRID: AB_3085673\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P47928\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869696282793,"sku":"21803-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21803-1-ap","provider":"Iright","version":"1.0","type":"link"}