{"product_id":"proteintech-21874-1-ap","title":"Proteintech, 21874-1-AP, AMIGO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AMIGO1 (21874-1-AP) by Proteintech is a Polyclonal antibody targeting AMIGO1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n21874-1-AP targets AMIGO1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAMIGO1 is a brain-enriched transmembrane immunoglobulin (Ig) superfamily protein with six extracellular leucine-rich repeats (LRR) and a single immunoglobulin-like (Ig) domain (PMID: 21938721). It is widely expressed in the central nervous system (CNS), and can be found in neurons, astrocytes as well as oligodendrocytes. AMIGO1 acts as a homophilic adhesion molecule that induces outgrowth and fasciculation of neurites in central neurons (PMID: 12629050). It has been reported that AMIGO1 is a glycosylated protein, the apparent molecular weight (70-80 kDa) is much higher than the predicted molecular size of AMIGO1 (55 kDa) (PMID: 12629050; 21938721; 22056818).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16226 Product name: Recombinant human AMIGO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 224-493 aa of BC040879 Sequence: NCDCELYQLFSHWQYRQLSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQSGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV Predict reactive species\nFull Name: adhesion molecule with Ig-like domain 1\nCalculated Molecular Weight: 493 aa, 55 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC040879\nGene Symbol: AMIGO1\nGene ID (NCBI): 57463\nRRID: AB_2878935\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86WK6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869809070249,"sku":"21874-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21874-1-ap","provider":"Iright","version":"1.0","type":"link"}