{"product_id":"proteintech-21901-1-ap","title":"Proteintech, 21901-1-AP, ANO10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANO10 (21901-1-AP) by Proteintech is a Polyclonal antibody targeting ANO10 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n21901-1-AP targets ANO10 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANO10, also named as TMEM16K, is 660 amino acid protein, which belongs to the anoctamin family. ANO10 does not exhibit calcium-activated chloride channel activity and can inhibit the activity of ANO1. ANO10 is Highly expressed in the brain. ANO10 may have an association with Spinocerebellar ataxia, autosomal recessive, 10.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13983 Product name: Recombinant human ANO10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-119 aa of BC038855 Sequence: MLLGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRRLLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPI Predict reactive species\nFull Name: anoctamin 10\nCalculated Molecular Weight: 660 aa, 76 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC038855\nGene Symbol: ANO10\nGene ID (NCBI): 55129\nRRID: AB_2878940\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NW15\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869636350121,"sku":"21901-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21901-1-ap","provider":"Iright","version":"1.0","type":"link"}