{"product_id":"proteintech-21907-1-ap","title":"Proteintech, 21907-1-AP, ZNF614 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF614 (21907-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF614 in IP, ELISA applications with reactivity to human samples\n21907-1-AP targets ZNF614 in IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF614 (Zinc Finger Protein 614) is a protein encoded by the ZNF614 gene in humans. It belongs to the zinc finger protein family, which typically functions in DNA binding and transcriptional regulation. Zinc finger proteins play roles in various cellular processes, including gene expression, cell differentiation, and development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14991 Product name: Recombinant human ZNF614 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-160 aa of BC004930 Sequence: MIKTQESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKLAHGQEPWTTDAKIQNKNCPGIGKVDSHLQEHSPNQRLLKSVQQCNGQNTLRNIVHLSKTHFPIVQNHDTFDLYRKNLKSSLSLINQKRRHGINNPVEFIG Predict reactive species\nFull Name: zinc finger protein 614\nCalculated Molecular Weight: 585 aa, 67 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC004930\nGene Symbol: ZNF614\nGene ID (NCBI): 80110\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N883\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887951138985,"sku":"21907-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21907-1-ap","provider":"Iright","version":"1.0","type":"link"}