{"product_id":"proteintech-21924-1-ap","title":"Proteintech, 21924-1-AP, VAV2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VAV2 (21924-1-AP) by Proteintech is a Polyclonal antibody targeting VAV2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n21924-1-AP targets VAV2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse brain tissue,  A431 cells,  NIH\/3T3 cells,  HeLa cells,  mouse liver tissue,  rat liver tissue,  SH-SY5Y cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human kidney tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16458 Product name: Recombinant human VAV2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 98-326 aa of BC132967 Sequence: DLFDVRDFGKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVV Predict reactive species\nFull Name: vav 2 guanine nucleotide exchange factor\nCalculated Molecular Weight: 839 aa, 97 kDa\nObserved Molecular Weight: 101 kDa\nGenBank Accession Number: BC132967\nGene Symbol: VAV2\nGene ID (NCBI): 7410\nRRID: AB_11182283\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52735\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869508030633,"sku":"21924-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21924-1-ap","provider":"Iright","version":"1.0","type":"link"}