{"product_id":"proteintech-21941-1-ap","title":"Proteintech, 21941-1-AP, DNAJC6\/AUXILIN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNAJC6\/AUXILIN (21941-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC6\/AUXILIN in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n21941-1-AP targets DNAJC6\/AUXILIN in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue,  rat brain tissue,  rat cerebellum tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNAJC6, also named AUXILIN, belongs to the evolutionarily conserved DNAJ\/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. It is a neuronal protein that functions specifically in the pathway of clathrin-mediated endocytosis. It shares homology with GAK, and the two proteins act as cochaperones to support the HSC70 -dependent clathrin uncoating of clathrin-coated vesicles (PMID: 2016009). DNAJC6 is expressed in various brain regions, including cerebellum, corpus callosum, cortex, striatum, brainstem, pons, putamen, spinal cord and substantia nigra (PMID: 23211418).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16612 Product name: Recombinant human DNAJC6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 387-733 aa of BC109279 Sequence: IPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDVELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLALGGQAPIDIPPDNPRHYGQSGFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFLNTSSASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHAKPGGFGMGSKSAATSPTGSSHGTPTHQSKPQTL Predict reactive species\nFull Name: DnaJ (Hsp40) homolog, subfamily C, member 6\nCalculated Molecular Weight: 970 aa, 106 kDa\nObserved Molecular Weight: 100-110 kDa, 86 kDa\nGenBank Accession Number: BC109279\nGene Symbol: DNAJC6\/AUXILIN\nGene ID (NCBI): 9829\nRRID: AB_2878951\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75061\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869457076393,"sku":"21941-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21941-1-ap","provider":"Iright","version":"1.0","type":"link"}