{"product_id":"proteintech-21945-1-ap","title":"Proteintech, 21945-1-AP, TOR1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TOR1B (21945-1-AP) by Proteintech is a Polyclonal antibody targeting TOR1B in WB, ELISA applications with reactivity to human, mouse, rat samples\n21945-1-AP targets TOR1B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTorsin A is 1 of 4 predicted mammalian torsin ATPases associated with assorted cellular activities (AAA+) proteins (PMID: 20015956). TOR1B (torsin family 1 member B), also called TorsinB (TorB), is similar to TorsinA at the sequence level. TorsinA and TorsinB are both ubiquitously expressed in all cell types though TorsinA is more highly expressed in neurons. TorsinA and TorsinB may be somewhat functionally redundant, with TorsinA being more important in neuronal cells and TorsinB being more important in other tissues (PMID: 24275647). TOR1B serve as a molecular chaperone assisting in the proper folding of secreted and\/or membrane proteins,and plays a role in non-neural cells nuclear envelope and endoplasmic reticulum integrity (PMID: 24275647; 23569223).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16641 Product name: Recombinant human TOR1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-77 aa of BC015578 Sequence: FEPITVGLAIGAASAITGYLSYNDIYCRFAECCREERPLNASALKLDLEEKLF Predict reactive species\nFull Name: torsin family 1, member B (torsin B)\nCalculated Molecular Weight: 336 aa, 38 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC015578\nGene Symbol: TOR1B\nGene ID (NCBI): 27348\nRRID: AB_3669382\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14657\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869779906729,"sku":"21945-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21945-1-ap","provider":"Iright","version":"1.0","type":"link"}