{"product_id":"proteintech-21951-1-ap","title":"Proteintech, 21951-1-AP, Urocortin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Urocortin (21951-1-AP) by Proteintech is a Polyclonal antibody targeting Urocortin in IHC, ELISA applications with reactivity to human samples\n21951-1-AP targets Urocortin in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human testis tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUrocortin is a member of the sauvagine\/corticotropin-releasing factor\/urotensin I family that includes CRF, urotensin I, sauvagine, urocortin II and urocortin III. . Urocortin is a potent anorexigenic peptide that induces fed-like motor activity when administered centrally or peripherally in fasted animals. Urocortin is also a potent and long-lasting hypotensive agent and increases coronary blood flow. Urocortin acts in vitro to stimulate the secretion of adrenocorticotropic hormone (ACTH) and binds with high affinity to CRF receptor types 1, 2-alpha, and 2-beta. Urocortin is synthesized as precursor, which is subsequently processed to the mature biologically active peptide (a 40-amino acid Molecule ).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15995 Product name: Recombinant human UCN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC104470 Sequence: MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK Predict reactive species\nFull Name: urocortin\nCalculated Molecular Weight: 124 aa, 13 kDa\nGenBank Accession Number: BC104470\nGene Symbol: UCN\nGene ID (NCBI): 7349\nRRID: AB_2878953\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P55089\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887917977769,"sku":"21951-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-21951-1-ap","provider":"Iright","version":"1.0","type":"link"}